PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo24G0021600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Dof
Protein Properties Length: 350aa    MW: 36447.6 Da    PI: 9.032
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo24G0021600genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.95.4e-3952110361
           zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                      +++l+cprCdstntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rk k++
  Spipo24G0021600  52 QQNLRCPRCDSTNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKAKTT 110
                      7899***************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-2651108IPR003851Zinc finger, Dof-type
PfamPF027011.0E-3253109IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.29255109IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105793IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MIQELLGGGQ VEANKIPIVG GSSSSSPLSS GPSSPAAAAV APPFSSATNS DQQNLRCPRC  60
DSTNTKFCYY NNYNLTQPRH FCKTCRRYWT KGGALRNVPI GGGCRKAKTT GVSAGRSTKA  120
KTLSSSDAAL IKSSLGGLSV GPPGFEQELP SSHILWPSPP NSHLLTLLRS TVNNTSSNSS  180
AITSNPNPDS NPNSARIKEE GALNLSHLVP DASLLRNALN ARNLGFDHLS QVPLGLSSPW  240
SSNQHQHGGF LFGETPTTGI QELYQRMRSH GQHQADHPEK SLGNVGPPPS TMSSFSPGAA  300
VAPSSPLLAS TAASGPGVLE TATLVGGEFG YWSSPFAWAD MPATNGSFP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1867482e-50AC186748.1 Musa acuminata clone MA4_8L21, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002310753.16e-91hypothetical protein POPTR_0007s11620g
TrEMBLA9P9B57e-91A9P9B5_POPTR; Uncharacterized protein
STRINGPOPTR_0007s11620.12e-90(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP77103144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.12e-34TARGET OF MONOPTEROS 6